General Information

  • ID:  hor006803
  • Uniprot ID:  A2VB90
  • Protein name:  Partner of bursicon
  • Gene name:  pburs; sc-burs;
  • Organism:  Apis mellifera
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Hymenoptera; Apocrita (wasps; ants; and bees); Aculeata; Apoidea (bees); Apidae (bumble bees and honey bees); Apinae (honey bees); Apini; Apis; Apis mellifera (Honeybee)
  • GO MF:  GO:0031395 bursicon neuropeptide hormone complex
  • GO BP:  GO:0005184 neuropeptide hormone activity; GO:0001664 G protein-coupled receptor binding
  • GO CC:  GO:0007186 G protein-coupled receptor signaling pathway

Sequence Information

  • Sequence:  VTDDENCETLQSEVHITKDEYDEIGRLKRTCSGDISVTKCEGFCNSQVQPSVASTTGFSKECYCCRESYLKERHITLHHCYDADGIKLMNEENGVMEIKIREPVECKCIKCGDISQ
  • Length:  116
  • Propeptide:  MKENFSIMFIHSIFLILIIFIYSNETIAQVTDDENCETLQSEVHITKDEYDEIGRLKRTCSGDISVTKCEGFCNSQVQPSVASTTGFSKECYCCRESYLKERHITLHHCYDADGIKLMNEENGVMEIKIREPVECKCIKCGDISQ
  • Signal peptide:  MKENFSIMFIHSIFLILIIFIYSNETIA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading.
  • Mechanism:  Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA